PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT19857
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 212aa    MW: 22666.5 Da    PI: 10.1136
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT19857genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding491.4e-15116160347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT++E+ +++ + ++lG+g+W+ I+r++ ++Rt+ q+ s+ qky
         EMT19857 116 PWTEDEHRRFLAGLEKLGKGDWRGISRHFVTTRTPTQVASHAQKY 160
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129420.245109165IPR017930Myb domain
SuperFamilySSF466893.14E-18110165IPR009057Homeodomain-like
TIGRFAMsTIGR015574.7E-19112164IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.601.3E-11113159IPR009057Homeodomain-like
SMARTSM007171.5E-11113163IPR001005SANT/Myb domain
PfamPF002491.4E-12116160IPR001005SANT/Myb domain
CDDcd001671.55E-10116161No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MARQCSSCGH NGHNSRTCSG HRGVESGGGG LRLFGVQLQL GAAPLKKSFS MECLSSSASA  60
YSAAAAAVGV AASNSSSSVS SSSSLVSVEE SPEKMGHGYL SDGLMGRAQE RKKGVPWTED  120
EHRRFLAGLE KLGKGDWRGI SRHFVTTRTP TQVASHAQKY FLRQAGLAQK KRRSSLFDVV  180
ARVVIRCFGD DDAIYLTKDR AISKELIISG DN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ6243990.0KJ624399.1 Triticum aestivum MYBSM151 mRNA, complete cds.
GenBankKP3304790.0KP330479.1 Triticum aestivum MYB transcription factor SM151 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003564752.13e-83PREDICTED: transcription factor MYB1R1-like
TrEMBLR7WBG41e-155R7WBG4_AEGTA; Myb-like protein J
STRINGMLOC_70777.21e-85(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42313873
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.11e-44MYB_related family protein